PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00096g00412.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family G2-like
Protein Properties Length: 412aa    MW: 45920.4 Da    PI: 6.5685
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00096g00412.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.51.5e-334498155
                   G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                              kprl+Wtp+LHerF+eav+qLGG++kAtPk++l+lm+++gLtl+h+kSHLQkYRl
  Peaxi162Scf00096g00412.1 44 KPRLKWTPDLHERFIEAVNQLGGADKATPKSVLKLMGIQGLTLYHLKSHLQKYRL 98
                              79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.3841101IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.2E-314299IPR009057Homeodomain-like
SuperFamilySSF466898.96E-174399IPR009057Homeodomain-like
TIGRFAMsTIGR015577.0E-244499IPR006447Myb domain, plants
PfamPF002492.4E-104697IPR001005SANT/Myb domain
PfamPF143792.2E-25142188IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 412 aa     Download sequence    Send to blast
MYHHHHQAAN VHPSTRMSYP ERHLFLQGGN ANGDSGLVLS TDAKPRLKWT PDLHERFIEA  60
VNQLGGADKA TPKSVLKLMG IQGLTLYHLK SHLQKYRLSK NLHGQSNTSG TIKAAAGIEK  120
ISESSGIPMS NPIIGQPNDD IPISEALQMQ IEVQRRLHEQ LEVQRHLQLR IEAQGKYLQA  180
VLEKAQETLG TQNLGTIGLE AAKVQLSDLV SKVSNQSLNS AFSEIKEISG FHTPQTQANQ  240
QGADCSINSC LTSSEGPLRD LQEMHNNQIG LRPLNFGPNE NETRLQQTEL RWRDDLNDNG  300
KLFTKMDEDT KKEFANETNW SNLSMGIGLQ GGKQNVNSSY FDGRLNEIDA DIKLFHQAAD  360
RSSISVKPEK QMSIQEYNKL PYFAPKLDLN TDDQTDAASS CKQLDLNGFS WS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754490.0HG975449.1 Solanum pennellii chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006339130.10.0PREDICTED: uncharacterized protein LOC102602766 isoform X1
TrEMBLK4D3C10.0K4D3C1_SOLLC; Uncharacterized protein
STRINGSolyc10g083340.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29462451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.31e-126G2-like family protein